Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbbp4 Rabbit Polyclonal Antibody (HRP)

Rbbp4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RBA, RBAP48, mRbAp48

UniProt

Q60972

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rbbp4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (323/A3), CF568 conjugate, 0.1mg/mL
BNC680396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2553), CF568 conjugate, 0.1mg/mL
BNC682553-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2553), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF647 conjugate, 0.1mg/mL
BNC470954-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGI2 Antibody
8C11278-AAT 50 µg

MAGI2 Antibody

Sign In for Pricing
View Details
BOD1 Polyclonal Antibody
E-AB-16283-01 20 µL

BOD1 Polyclonal Antibody

Sign In for Pricing
View Details
BOD1 Polyclonal Antibody
E-AB-16283-02 60 µL

BOD1 Polyclonal Antibody

Sign In for Pricing
View Details