Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGK1 Rabbit Polyclonal Antibody (Biotin)

SGK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SGK

UniProt

E9PR89

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SGK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001278924.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit
MBS2886577-01 48 Well

Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit
MBS2886577-02 96 Well

Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit
MBS2886577-03 5x 96 Well

Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit
MBS2886577-04 10x 96 Well

Bovine Mitochondrial brown fat uncoupling protein 1 ELISA Kit

Sign In for Pricing
View Details
C-Peptide (CP) Magnetic Fluorescence Assay Kit
MBS2155519-01 96 Tests

C-Peptide (CP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
C-Peptide (CP) Magnetic Fluorescence Assay Kit
MBS2155519-02 5x 96 Tests

C-Peptide (CP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details