Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT2 Rabbit Polyclonal Antibody (FITC)

SEPT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DIFF6, NEDD5, SEPT2, NEDD-5, Pnutl3, hNedd5

UniProt

Q15019

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasmodium vivax MSP1 (Plasmodium vivax merozoite surface protein 1) (PE) discontinued
P4256-75L-PE 100 µL

Plasmodium vivax MSP1 (Plasmodium vivax merozoite surface protein 1) (PE) discontinued

Sign In for Pricing
View Details
DUSP3, CT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR)
MBS631177-01 0.2 mL

DUSP3, CT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR)

Sign In for Pricing
View Details
DUSP3, CT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR)
MBS631177-02 5x 0.2 mL

DUSP3, CT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR)

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Hoof Fresh
IGBOHFF 1 Each

Innovative Grade US Origin Bovine Hoof Fresh

Sign In for Pricing
View Details
NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 550) discontinued
039091-ML550 100 µL

NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Factor Related Apoptosis (FAS) ELISA Kit
MBS450979-01 48 Tests

Mouse Factor Related Apoptosis (FAS) ELISA Kit

Sign In for Pricing
View Details