Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT2 Rabbit Polyclonal Antibody (HRP)

SEPT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DIFF6, NEDD5, SEPT2, NEDD-5, Pnutl3, hNedd5

UniProt

Q15019

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEPT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCKAP1 (NM_013436) Human Over-expression Lysate
LS010787 100 µg

NCKAP1 (NM_013436) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human PEX11A shRNA (UAS) - Lentiviral human PEX11A shRNA (UAS, GFP) (100)
GTR15338844 1 Vial

Lentiviral human PEX11A shRNA (UAS) - Lentiviral human PEX11A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-Cyclophilin B Antibody, Rabbit Polyclonal
MBS8125415-01 0.1 mL

Anti-Cyclophilin B Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cyclophilin B Antibody, Rabbit Polyclonal
MBS8125415-02 5x 0.1 mL

Anti-Cyclophilin B Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
2310044G17Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4795807 1.0 µg DNA

2310044G17Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human STX2 Protein, N-His
AP91448 50 µg

Recombinant Human STX2 Protein, N-His

Sign In for Pricing
View Details