Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Orc2 Rabbit Polyclonal Antibody (Biotin)

Orc2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Or, Orc2l, AU041563

UniProt

Q59IX1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Orc2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP1 Antibody
orb1332113 100 µg

BNIP1 Antibody

Sign In for Pricing
View Details
TNFAIP8 (Tumor Necrosis Factor alpha-induced Protein 8, TNF alpha-induced Protein 8, Head and Neck Tumor and Metastasis-related Protein, MDC-3.13, NF-kappa-B-inducible DED-containing Protein, NDED, SCCS2, SCC-S2, TNF-induced Protein GG2-1)
134534 50 µg

TNFAIP8 (Tumor Necrosis Factor alpha-induced Protein 8, TNF alpha-induced Protein 8, Head and Neck Tumor and Metastasis-related Protein, MDC-3.13, NF-kappa-B-inducible DED-containing Protein, NDED, SCCS2, SCC-S2, TNF-induced Protein GG2-1)

Sign In for Pricing
View Details
HTR3A (5HT3R, HTR3) discontinued
510427 100 µg

HTR3A (5HT3R, HTR3) discontinued

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody (Fluoro488)
orb3078549 100 µg

Met Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
HLTF Antibody
CSB-PA791283-01 50 μL

HLTF Antibody

Sign In for Pricing
View Details
HLTF Antibody
CSB-PA791283-02 100 µL

HLTF Antibody

Sign In for Pricing
View Details