Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Orc2 Rabbit Polyclonal Antibody (HRP)

Orc2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Or, Orc2l, AU041563

UniProt

Q59IX1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Orc2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LTF/LF (Lactoferrin) ValidElisa Kit
EK341913 96 Well

Human LTF/LF (Lactoferrin) ValidElisa Kit

Sign In for Pricing
View Details
Lentiviral human CBX3 shRNA (UAS) - Lentiviral human CBX3 shRNA (UAS, GFP) plasmid
GTR15311257 1 Vial

Lentiviral human CBX3 shRNA (UAS) - Lentiviral human CBX3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Hsa-miR-6796-3p miRNA Antagomir
orb1914054-01 10 nmol

Hsa-miR-6796-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6796-3p miRNA Antagomir
orb1914054-02 20 nmol

Hsa-miR-6796-3p miRNA Antagomir

Sign In for Pricing
View Details
Tear-off 8-tube Mat, 0,2 ml, RP, SFGC
B58001-1 25 Mats/Box (300 Strips)

Tear-off 8-tube Mat, 0,2 ml, RP, SFGC

Sign In for Pricing
View Details
Recombinant Human NDUFS1 Protein, N-His
orb2836084-01 20 µg

Recombinant Human NDUFS1 Protein, N-His

Sign In for Pricing
View Details