Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4d Rabbit Polyclonal Antibody (Biotin)

Pde4d Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dpde, dunc, Dpde3, 9630011N22Rik

UniProt

Q01063

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035186

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL1 (Cyclin L1, Cyclin-L1, Cyclin-L, BM-001, UNQ530/PRO1073, ANIA6A, Ania-6A) (HRP)
124484-HRP 100 µL

CCNL1 (Cyclin L1, Cyclin-L1, Cyclin-L, BM-001, UNQ530/PRO1073, ANIA6A, Ania-6A) (HRP)

Sign In for Pricing
View Details
Anti-Phospho-ATM (Ser367) Polyclonal Antibody
TMAC-00331-01 50 μL

Anti-Phospho-ATM (Ser367) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ATM (Ser367) Polyclonal Antibody
TMAC-00331-02 100 µL

Anti-Phospho-ATM (Ser367) Polyclonal Antibody

Sign In for Pricing
View Details
EHMT1, ID (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, Histone-lysine N-methyltransferase, H3 Lysine-9 Specific 5) (FITC) discontinued
E8947-50F-FITC 200 µL

EHMT1, ID (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, Histone-lysine N-methyltransferase, H3 Lysine-9 Specific 5) (FITC) discontinued

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042129-01 0.1 mL

FITC-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042129-02 0.2 mL

FITC-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details