Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4d Rabbit Polyclonal Antibody (HRP)

Pde4d Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dpde, dunc, Dpde3, 9630011N22Rik

UniProt

Q01063

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035186

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DROSHA Human Over-expression Lysate
orb1347672 100 µg

DROSHA Human Over-expression Lysate

Sign In for Pricing
View Details
GABAB R2 (E-4)
sc-393286 200 µg/mL

GABAB R2 (E-4)

Sign In for Pricing
View Details
TNIK (S764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (MaxLight 550)
MBS6503242-01 0.1 mL

TNIK (S764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (MaxLight 550)

Sign In for Pricing
View Details
TNIK (S764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (MaxLight 550)
MBS6503242-02 5x 0.1 mL

TNIK (S764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (MaxLight 550)

Sign In for Pricing
View Details
APOE Knockout A2780 Polyclonal Cells
ARG28744 1 Million

APOE Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Thermotoga maritima ATP synthase epsilon chain (atpC)
MBS1311946-01 0.02 mg (E-Coli)

Recombinant Thermotoga maritima ATP synthase epsilon chain (atpC)

Sign In for Pricing
View Details