Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pfkfb2 Rabbit Polyclonal Antibody (HRP)

Pfkfb2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4930568D07Rik

UniProt

Q6GTL7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032851

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GYY 4137
451574-01 10 mg

GYY 4137

Sign In for Pricing
View Details
GYY 4137
451574-02 25 mg

GYY 4137

Sign In for Pricing
View Details
Trimethyl orthobutyrate
FT37486 25 g

Trimethyl orthobutyrate

Sign In for Pricing
View Details
Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit
MBS9940825-01 48 Well

Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit

Sign In for Pricing
View Details
Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit
MBS9940825-02 96 Well

Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit

Sign In for Pricing
View Details
Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit
MBS9940825-03 5x 96 Well

Hamster U1 Small Nuclear Ribonucleoprotein 70 kDa Antibody (Anti-SNRNP70) ELISA Kit

Sign In for Pricing
View Details