Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phkg1 Rabbit Polyclonal Antibody (Biotin)

Phkg1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Phkg, PHKIN01

UniProt

P13286

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike RBD Protein (R346K, E484K, N501Y), His Tag (MALS verified)
SPD-C5221-1mg 1 mg

SARS-CoV-2 Spike RBD Protein (R346K, E484K, N501Y), His Tag (MALS verified)

Sign In for Pricing
View Details
Ice Flaker BIFL-210
BIFL-210 1 Unit

Ice Flaker BIFL-210

Sign In for Pricing
View Details
MICA Mouse Monoclonal Antibody [Clone ID: AMO1]
AM26571AF-N 100 µg

MICA Mouse Monoclonal Antibody [Clone ID: AMO1]

Sign In for Pricing
View Details
Mouse Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
RDR-LPCAT2-Mu-01 96 Tests

Mouse Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
RDR-LPCAT2-Mu-02 48 Tests

Mouse Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
CLCC1 Human Gene Knockout Kit (CRISPR)
KN402649 1 Kit

CLCC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details