Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIN4 Rabbit Polyclonal Antibody (Biotin)

PIN4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EPVH, PAR14, PAR17

UniProt

Q9Y237

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PIN4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006214

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLECL1 Peptide
orb1233552 0.1 mg

SIGLECL1 Peptide

Sign In for Pricing
View Details
Anti-Human CD116/CSF2RA Antibody (CAM-3001), FITC
FHD11511 100 Tests

Anti-Human CD116/CSF2RA Antibody (CAM-3001), FITC

Sign In for Pricing
View Details
Human LYZL4 Pre-designed siRNA Set A
SI009064A 1 Each

Human LYZL4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human GTF2I sgRNA gene knockout kit - Lentiviral human GTF2I sgRNA gene knockout kit (25)
GTR15395847 1 Vial

Lentiviral human GTF2I sgRNA gene knockout kit - Lentiviral human GTF2I sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MUC6 Protein Vector (Mouse) (pPB-C-His)
PV203010 500 ng

MUC6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (MaxLight 550)
MBS6498067-01 0.1 mL

RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (MaxLight 550)

Sign In for Pricing
View Details