Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5E Rabbit Polyclonal Antibody (Biotin)

PPP2R5E Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B56E, B56epsilon

UniProt

Q16537

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5E

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006237

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL22P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV778210 1.0 µg DNA

RPL22P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TipOne RPT 300 uL ultra low retention filter pipette tip refill, sterile, 10 cassettes of 96 tips (960 tips)
1180-9710 960 Tips

TipOne RPT 300 uL ultra low retention filter pipette tip refill, sterile, 10 cassettes of 96 tips (960 tips)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)
MBS1376571-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)
MBS1376571-02 0.1 mg (E-Coli)

Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)
MBS1376571-03 0.02 mg (Yeast)

Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)
MBS1376571-04 0.1 mg (Yeast)

Recombinant Vibrio fischeri UPF0149 protein VF_2102 (VF_2102)

Sign In for Pricing
View Details