Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp2r5e Rabbit Polyclonal Antibody (Biotin)

Ppp2r5e Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B56bet, B56beta, 4633401M22Rik

UniProt

Q61151

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR Rabbit Polyclonal Antibody (HRP)
orb2096849 100 µL

AMACR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Genorise® Anti-canine TNFRII Polyclonal Antibody
GR105180 100 µg

Genorise® Anti-canine TNFRII Polyclonal Antibody

Sign In for Pricing
View Details
TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) (MaxLight 490)
MBS6203653-01 0.1 mL

TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) (MaxLight 490)

Sign In for Pricing
View Details
TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) (MaxLight 490)
MBS6203653-02 5x 0.1 mL

TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) (MaxLight 490)

Sign In for Pricing
View Details
Fetuin A Rabbit mAb
RDSA66106 100 µL

Fetuin A Rabbit mAb

Sign In for Pricing
View Details
MTA1 Rabbit Polyclonal Antibody
E10G13721 100 µL

MTA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details