Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCD Rabbit Polyclonal Antibody (Biotin)

PRKCD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAY1, PKCD, ALPS3, CVID9, nPKC-delta

UniProt

Q05655

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PRKCD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001303256.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (HRP)
137603-HRP 100 µL

Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (HRP)

Sign In for Pricing
View Details
Recombinant CD30 Antibody
V3568SAF-100UG 100 µg

Recombinant CD30 Antibody

Sign In for Pricing
View Details
Canine Myoglobin (MB) ELISA Kit
orb1653657-01 48 Tests

Canine Myoglobin (MB) ELISA Kit

Sign In for Pricing
View Details
Canine Myoglobin (MB) ELISA Kit
orb1653657-02 96 Tests

Canine Myoglobin (MB) ELISA Kit

Sign In for Pricing
View Details
CXCL2/GRO beta Polyclonal Antibody
MBS2579040-01 0.025 mL

CXCL2/GRO beta Polyclonal Antibody

Sign In for Pricing
View Details
CXCL2/GRO beta Polyclonal Antibody
MBS2579040-02 0.1 mL

CXCL2/GRO beta Polyclonal Antibody

Sign In for Pricing
View Details