Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rad21 Rabbit Polyclonal Antibody (FITC)

Rad21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC116373, Rad21

UniProt

Q4KLH7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Insl3 shRNA (UAS) - Lentiviral mouse Insl3 shRNA (UAS, iRFP) plasmid
GTR15217912 1 Vial

Lentiviral mouse Insl3 shRNA (UAS) - Lentiviral mouse Insl3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Pas-3 Antibody
orb801532 2 mg

Pas-3 Antibody

Sign In for Pricing
View Details
GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (AP)
MBS6301049-01 0.2 mL

GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (AP)

Sign In for Pricing
View Details
GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (AP)
MBS6301049-02 5x 0.2 mL

GAL, CT (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (AP)

Sign In for Pricing
View Details
TAL1 Antibody
orb1335539 100 µg

TAL1 Antibody

Sign In for Pricing
View Details
Recombinant Human CD155/PVR Protein
MBS9141833-01 0.005 mg

Recombinant Human CD155/PVR Protein

Sign In for Pricing
View Details