Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAN Rabbit Polyclonal Antibody (HRP)

RAN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TC4, Gsp1, ARA24

UniProt

P62826

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAP24P AAV siRNA Pooled Vector
48266161 1.0 µg

TRNAP24P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Zebrafish Nemp1 Rabbit Polyclonal Antibody
orb1152273 200 µL

Zebrafish Nemp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCDH Recombinant Rabbit mAb
BS45673-01 50 µL

GCDH Recombinant Rabbit mAb

Sign In for Pricing
View Details
GCDH Recombinant Rabbit mAb
BS45673-02 100 µL

GCDH Recombinant Rabbit mAb

Sign In for Pricing
View Details
CX3CR1 (Chemokine (C-X3-C Motif) Receptor 1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28) (MaxLight 650)
245094-ML650 100 µL

CX3CR1 (Chemokine (C-X3-C Motif) Receptor 1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28) (MaxLight 650)

Sign In for Pricing
View Details
DYRK3 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-9520R-APC-Cy5.5 100 µL

DYRK3 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details