Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Rabbit Polyclonal Antibody (Biotin)

RPL10A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L10A, CSA19, NEDD6, Csa-19

UniProt

P62906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPL10A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009035

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smap1 Mouse shRNA Lentiviral Particle (Locus ID 98366)
TL505553V 500 µL Each

Smap1 Mouse shRNA Lentiviral Particle (Locus ID 98366)

Sign In for Pricing
View Details
Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit
MBS8800961-01 48 Strip Well

Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit
MBS8800961-02 96 Strip Well

Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit
MBS8800961-03 5x 96 Strip Well

Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit
MBS8800961-04 10x 96 Strip Well

Human PGD2S (Prostaglandin D2 Synthase, Brain) ELISA Kit

Sign In for Pricing
View Details
SPHKAP shRNA (m) Lentiviral Particles
sc-153753-V 200 µL

SPHKAP shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details