Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Rabbit Polyclonal Antibody (HRP)

RPL10A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L10A, CSA19, NEDD6, Csa-19

UniProt

P62906

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPL10A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009035

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCK1 Rabbit Polyclonal Antibody
E53P12491 100 µL

NCK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Endostatin Rabbit Polyclonal Antibody (Cy5)
orb2438043 100 µL

Endostatin Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila nuoN Protein (aa 1-480)
VAng-Lsx3966-inquire Inquire

Recombinant Legionella Pneumophila nuoN Protein (aa 1-480)

Sign In for Pricing
View Details
Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]
MBS2558072-01 0.025 mg

Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]

Sign In for Pricing
View Details
Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]
MBS2558072-02 0.1 mg

Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]

Sign In for Pricing
View Details
Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]
MBS2558072-03 5x 0.1 mg

Anti-Mouse CD62L Monoclonal Antibody (AF647 Conjugated) [Mel14]

Sign In for Pricing
View Details