Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl3 Rabbit Polyclonal Antibody (HRP)

Ubl3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HCG, MUB, mmMUB, AW108023

UniProt

Q9Z2M6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ubl3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036038

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (IAP/964), CF647 conjugate, 0.1mg/mL
BNC470964-100 1x 100 µL

CD47 (IAP/964), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 647 PSA™ Imaging Kit with Goat Anti-Rabbit IgG
45240-AAT 100 Tests

IFluor® 647 PSA™ Imaging Kit with Goat Anti-Rabbit IgG

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF568 conjugate, 0.1mg/mL
BNC681631-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL
BNC680950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse OPG (Osteoprotegerin) ELISA Kit
E-EL-M0081-01 24 Tests

Mouse OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details
Mouse OPG (Osteoprotegerin) ELISA Kit
E-EL-M0081-02 48 Tests

Mouse OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details