Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Rabbit Polyclonal Antibody (FITC)

MSRA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PMSR

UniProt

Q9UJ68

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MSRA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FK506 Binding Protein 1B (FKBP1B) ELISA Kit
orb781162-01 48 Tests

Mouse FK506 Binding Protein 1B (FKBP1B) ELISA Kit

Sign In for Pricing
View Details
Mouse FK506 Binding Protein 1B (FKBP1B) ELISA Kit
orb781162-02 96 Tests

Mouse FK506 Binding Protein 1B (FKBP1B) ELISA Kit

Sign In for Pricing
View Details
ZMAT4 Antibody, Biotin conjugated
CSB-PA867172LD01HU-01 50 µg

ZMAT4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ZMAT4 Antibody, Biotin conjugated
CSB-PA867172LD01HU-02 100 µg

ZMAT4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA Kit
orb2812774-01 48 Tests

Human Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA Kit
orb2812774-02 96 Tests

Human Fatty Acid Binding Protein 5, Epidermal (FABP5) ELISA Kit

Sign In for Pricing
View Details