Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Rabbit Polyclonal Antibody (HRP)

MSRA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PMSR

UniProt

Q9UJ68

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MSRA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD137 (4-1BB, TNFRSF9, 4-1BB ligand receptor, CD137, CD137 antigen, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, Tumor necrosis factor receptor superfamily member 9 precursor) (BSA & Azide Free) (AP) discontinued
C2548-50X-AP 100 µL

CD137 (4-1BB, TNFRSF9, 4-1BB ligand receptor, CD137, CD137 antigen, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, Tumor necrosis factor receptor superfamily member 9 precursor) (BSA & Azide Free) (AP) discontinued

Sign In for Pricing
View Details
2,4-Dichlorophenoxyacetic (2,4-D) Acid Solution (10 mg/mL)
B2022798 100 mL

2,4-Dichlorophenoxyacetic (2,4-D) Acid Solution (10 mg/mL)

Sign In for Pricing
View Details
Klhdc3 ORF Vector (Rat) (pORF)
ORF069099 1.0 µg DNA

Klhdc3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
SNX4 (Sorting Nexin-4) (Biotin)
133676-Biotin 100 µL

SNX4 (Sorting Nexin-4) (Biotin)

Sign In for Pricing
View Details
Guinea pig Kallikrein 3 ELISA Kit
MBS745083-01 48 Well

Guinea pig Kallikrein 3 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Kallikrein 3 ELISA Kit
MBS745083-02 96 Well

Guinea pig Kallikrein 3 ELISA Kit

Sign In for Pricing
View Details