Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6 Rabbit Polyclonal Antibody (HRP)

S100A6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2A9, PRA, 5B10, CABP, CACY, S10A6

UniProt

P06703

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human S10A6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055439

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1beta
orb1987316-01 25 mg

Interleukin 1beta

Sign In for Pricing
View Details
Interleukin 1beta
orb1987316-02 50 mg

Interleukin 1beta

Sign In for Pricing
View Details
Interleukin 1beta
orb1987316-03 100 mg

Interleukin 1beta

Sign In for Pricing
View Details
Pyruvate Dehydrogenase E1 component subunit β mitochondrial (PDHB) Rat ELISA Kit
G5958 96 Tests

Pyruvate Dehydrogenase E1 component subunit β mitochondrial (PDHB) Rat ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Estrone (E1) Monoclonal Antibody
VD2N354 1 Each

Mouse Anti-Estrone (E1) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SAFB1 (2E8) Mouse Monoclonal Antibody
MA5022-.1 100 µL

Anti-SAFB1 (2E8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details