Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR5 Rabbit Polyclonal Antibody (FITC)

PRR5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PP610, PROTOR1, PROTOR-1, FLJ20185k

UniProt

B3KRM4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bd Purecoat Amine Surface 175cm Vented Cap Flasks
354728 5 / PCK

Bd Purecoat Amine Surface 175cm Vented Cap Flasks

Sign In for Pricing
View Details
MEGF9 Rabbit Polyclonal Antibody
TA358952 100 µL

MEGF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)
MBS1177164-01 0.02 mg (E-Coli)

Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)

Sign In for Pricing
View Details
Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)
MBS1177164-02 0.1 mg (E-Coli)

Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)

Sign In for Pricing
View Details
Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)
MBS1177164-03 0.02 mg (Yeast)

Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)

Sign In for Pricing
View Details
Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)
MBS1177164-04 0.1 mg (Yeast)

Recombinant Betula pendula Major pollen allergen Bet v 1-F/I (BETV1F)

Sign In for Pricing
View Details