Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR5 Rabbit Polyclonal Antibody (HRP)

PRR5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP610, PROTOR1, PROTOR-1, FLJ20185k

UniProt

B3KRM4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid
OR1065825-01 100 mg

(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid

Sign In for Pricing
View Details
(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid
OR1065825-02 250 mg

(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid

Sign In for Pricing
View Details
(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid
OR1065825-03 1 g

(2- (3,6-Dimethyl-9H-carbazol-9-yl) ethyl) phosphonic acid

Sign In for Pricing
View Details
PTPDC1 Human Over-expression Lysate
orb1376281 20 µg

PTPDC1 Human Over-expression Lysate

Sign In for Pricing
View Details
DEFB133 (NM_001166478) Human Tagged Lenti ORF Clone
RC229491L4 10 µg

DEFB133 (NM_001166478) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Divalent Metal Transporter 1 (DMT1) BioAssayTM ELISA Kit (Human)
152511 96 Tests

Divalent Metal Transporter 1 (DMT1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details