Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lap3 Rabbit Polyclonal Antibody (Biotin)

Lap3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pe, Lap, Pep, Pep7, Peps, LAP-3, Lapep, Pep-7, Pep-S, AA410100, 2410015L10Rik

UniProt

Q9CPY7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN10 (NM_013236) Human Mass Spec Standard
PH301300 10 µg

ATXN10 (NM_013236) Human Mass Spec Standard

Sign In for Pricing
View Details
TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (MaxLight 550)
MBS6214513-01 0.1 mL

TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (MaxLight 550)

Sign In for Pricing
View Details
TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (MaxLight 550)
MBS6214513-02 5x 0.1 mL

TRAPPC2 (Trafficking Protein Particle Complex Subunit 2, Sedlin, SEDL) (MaxLight 550)

Sign In for Pricing
View Details
B230219D22Rik Protein Vector (Mouse) (pPM-C-His)
PV157945 500 ng

B230219D22Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Valbenazine tosylate
MBS5756956 Inquire

Valbenazine tosylate

Sign In for Pricing
View Details
Recombinant Human Kinesin-like protein KIFC1 (KIFC1)
orb1785505-01 20 µg

Recombinant Human Kinesin-like protein KIFC1 (KIFC1)

Sign In for Pricing
View Details