Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lap3 Rabbit Polyclonal Antibody (HRP)

Lap3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pe, Lap, Pep, Pep7, Peps, LAP-3, Lapep, Pep-7, Pep-S, AA410100, 2410015L10Rik

UniProt

Q9CPY7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNP Mouse Monoclonal Antibody (PE)
orb2602446 100 µg

PNP Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Fluor 750 Labeling Kit
MBS2571518-01 1 Reaction

Fluor 750 Labeling Kit

Sign In for Pricing
View Details
Fluor 750 Labeling Kit
MBS2571518-02 3 Reactions

Fluor 750 Labeling Kit

Sign In for Pricing
View Details
Fluor 750 Labeling Kit
MBS2571518-03 10 Reactions

Fluor 750 Labeling Kit

Sign In for Pricing
View Details
Fluor 750 Labeling Kit
MBS2571518-04 5x 10 Reactions

Fluor 750 Labeling Kit

Sign In for Pricing
View Details
TREX2 (Three Prime Repair Exonuclease 2, 3'-5' Exonuclease TREX2, Trex2) (FITC) discontinued
302807-FITC 200 µL

TREX2 (Three Prime Repair Exonuclease 2, 3'-5' Exonuclease TREX2, Trex2) (FITC) discontinued

Sign In for Pricing
View Details