Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POP5 Rabbit Polyclonal Antibody (FITC)

POP5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RPP2, RPP20, hPop5, HSPC004

UniProt

Q969H6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POP5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPA2 (Surfactant Associated Protein A2, SFTPA2B, COLEC5, SP2A, SPA1 beta, SP-A2, SPAII, Collectin-5, Pulmonary Surfactant Protein A2, 35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein)
365145 200 µL

SPA2 (Surfactant Associated Protein A2, SFTPA2B, COLEC5, SP2A, SPA1 beta, SP-A2, SPAII, Collectin-5, Pulmonary Surfactant Protein A2, 35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein)

Sign In for Pricing
View Details
Anti-KLHL15 Antibody
CQA4890-01 30 µL

Anti-KLHL15 Antibody

Sign In for Pricing
View Details
Anti-KLHL15 Antibody
CQA4890-02 50 μL

Anti-KLHL15 Antibody

Sign In for Pricing
View Details
Anti-KLHL15 Antibody
CQA4890-03 100 µL

Anti-KLHL15 Antibody

Sign In for Pricing
View Details
Anti-KLHL15 Antibody
CQA4890-04 200 µL

Anti-KLHL15 Antibody

Sign In for Pricing
View Details
RANBP9 Rabbit Polyclonal Antibody (Biotin)
orb2582935 100 µg

RANBP9 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details