Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27L Rabbit Polyclonal Antibody (Biotin)

RPS27L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q71UM5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS27L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_057004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9357945-01 48 Well

Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details
Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9357945-02 96 Well

Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details
Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9357945-03 5x 96 Well

Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details
Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9357945-04 10x 96 Well

Camel DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details
OTOS Human Over-expression Lysate
orb1353236 100 µg

OTOS Human Over-expression Lysate

Sign In for Pricing
View Details
IgG F (ab') 2 Antibody
OARA04489-2ML 2 mL

IgG F (ab') 2 Antibody

Sign In for Pricing
View Details