Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT6 Rabbit Polyclonal Antibody (Biotin)

TRMT6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCD10, CGI-09, Gcd10p

UniProt

Q9UJA5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRMT6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin E1 (CCNE1) (NM_001238) Human Recombinant Protein
E45H30350E1 50 µg

Cyclin E1 (CCNE1) (NM_001238) Human Recombinant Protein

Sign In for Pricing
View Details
BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (FITC) discontinued
B2553-62-FITC 200 µL

BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (FITC) discontinued

Sign In for Pricing
View Details
Rno-miR-29a-3p miRNA Mimic
CMR0070-01 5 nmol

Rno-miR-29a-3p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-29a-3p miRNA Mimic
CMR0070-02 10 nmol

Rno-miR-29a-3p miRNA Mimic

Sign In for Pricing
View Details
PCMV-EGFP-SLC6A1-Neo Plasmid
PVT83434 2 µg

PCMV-EGFP-SLC6A1-Neo Plasmid

Sign In for Pricing
View Details
MIOX Protein Vector (Human) (pPB-N-His)
PV025990 500 ng

MIOX Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details