Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSIP Rabbit Polyclonal Antibody (FITC)

NOSIP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NOSIP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057037

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC688553 CRISPRa sgRNA lentivector (set of three targets)(Rat)
27441126 3x 1.0µg DNA

LOC688553 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal CD163 Antibody (M130/8822R) [mFluor Violet 450 SE]
NBP3-24218MFV450 0.1 mL

Rabbit Monoclonal CD163 Antibody (M130/8822R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
CC2D1B Rabbit Polyclonal Antibody
orb325744 100 µL

CC2D1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal C7orf26 Antibody
NBP2-55233-25ul 25 µL

Rabbit Polyclonal C7orf26 Antibody

Sign In for Pricing
View Details
Neurokinin B Receptor (MGC148060, MGC148061, Neuromedin K Receptor, Neurokinin 3 Receptor, NK3 Receptor, NK-3 Receptor, NK3R, NK-3R, NKR, Tachykinin Receptor 3, TAC3R, TAC3RL, TACR3) (MaxLight 405)
MBS6489873-01 0.1 mL

Neurokinin B Receptor (MGC148060, MGC148061, Neuromedin K Receptor, Neurokinin 3 Receptor, NK3 Receptor, NK-3 Receptor, NK3R, NK-3R, NKR, Tachykinin Receptor 3, TAC3R, TAC3RL, TACR3) (MaxLight 405)

Sign In for Pricing
View Details
Neurokinin B Receptor (MGC148060, MGC148061, Neuromedin K Receptor, Neurokinin 3 Receptor, NK3 Receptor, NK-3 Receptor, NK3R, NK-3R, NKR, Tachykinin Receptor 3, TAC3R, TAC3RL, TACR3) (MaxLight 405)
MBS6489873-02 5x 0.1 mL

Neurokinin B Receptor (MGC148060, MGC148061, Neuromedin K Receptor, Neurokinin 3 Receptor, NK3 Receptor, NK-3 Receptor, NK3R, NK-3R, NKR, Tachykinin Receptor 3, TAC3R, TAC3RL, TACR3) (MaxLight 405)

Sign In for Pricing
View Details