Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSIP Rabbit Polyclonal Antibody (HRP)

NOSIP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NOSIP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057037

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jacalin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW10F4-JAC 10x 96 Well Plates

Jacalin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (DO-1), CF594 conjugate, 0.1mg/mL
BNC941658-500 1x 500 µL

P53 Tumor Suppressor Protein (DO-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LDHC Polyclonal Antibody
E-AB-40384-01 25 µL

LDHC Polyclonal Antibody

Sign In for Pricing
View Details
LDHC Polyclonal Antibody
E-AB-40384-02 100 µL

LDHC Polyclonal Antibody

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL
BNC680843-500 1x 500 µL

CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details