Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Rabbit Polyclonal Antibody (Biotin)

MEMO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MEMO, C2orf4, CGI-27, NS5ATP7

UniProt

Q9Y316

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEMO1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057039

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GLRB shRNA (UAS) - Lentiviral human GLRB shRNA (UAS) plasmid
GTR15139459 1 Vial

Lentiviral human GLRB shRNA (UAS) - Lentiviral human GLRB shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1307977-01 0.02 mg (E-Coli)

Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)

Sign In for Pricing
View Details
Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1307977-02 0.1 mg (E-Coli)

Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)

Sign In for Pricing
View Details
Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1307977-03 0.02 mg (Yeast)

Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)

Sign In for Pricing
View Details
Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1307977-04 0.1 mg (Yeast)

Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)

Sign In for Pricing
View Details
Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1307977-05 0.02 mg (Baculovirus)

Recombinant Bifidobacterium longum Arginine biosynthesis bifunctional protein ArgJ (argJ)

Sign In for Pricing
View Details