Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX7 Rabbit Polyclonal Antibody (HRP)

SNX7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZP564F052, MGC8717

UniProt

Q9UNH6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SNX7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dmbx1 (NM_130865) Mouse Tagged Lenti ORF Clone
MR223179L3 10 µg

Dmbx1 (NM_130865) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PSMD3 (Proteasome 26S Subunit, Non ATPase 3, S3, P58, RPN3, TSTA2) (APC)
MBS6433702-01 0.1 mL

PSMD3 (Proteasome 26S Subunit, Non ATPase 3, S3, P58, RPN3, TSTA2) (APC)

Sign In for Pricing
View Details
PSMD3 (Proteasome 26S Subunit, Non ATPase 3, S3, P58, RPN3, TSTA2) (APC)
MBS6433702-02 5x 0.1 mL

PSMD3 (Proteasome 26S Subunit, Non ATPase 3, S3, P58, RPN3, TSTA2) (APC)

Sign In for Pricing
View Details
Beta Defensin 1 Rabbit Monoclonal Antibody
AMRe84409-01 1 Each

Beta Defensin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Beta Defensin 1 Rabbit Monoclonal Antibody
AMRe84409-02 50 µL

Beta Defensin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Beta Defensin 1 Rabbit Monoclonal Antibody
AMRe84409-03 100 µL

Beta Defensin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details