Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS2 Rabbit Polyclonal Antibody (FITC)

MRPS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S2mt, CGI-91, MRP-S2, COXPD36

UniProt

Q9Y399

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057118

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 2H2 discontinued
344908-01 100 µL

Olfactory receptor 2H2 discontinued

Sign In for Pricing
View Details
Olfactory receptor 2H2 discontinued
344908-02 200 µL

Olfactory receptor 2H2 discontinued

Sign In for Pricing
View Details
Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit
MBS8800731-01 48 Strip Well

Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit
MBS8800731-02 96 Strip Well

Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit
MBS8800731-03 5x 96 Strip Well

Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit
MBS8800731-04 10x 96 Strip Well

Human LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit

Sign In for Pricing
View Details