Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRELID3B Rabbit Polyclonal Antibody (HRP)

PRELID3B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLMO2, C20orf45, dJ543J19.5

UniProt

A5GFX0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057129

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SARS-CoV-2 Spike Antibody (1C3H9) [mFluor Violet 450 SE]
NBP3-12855MFV450 0.1 mL

Mouse Monoclonal SARS-CoV-2 Spike Antibody (1C3H9) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Sheep Ladinin-1 (LAD1) ELISA Kit
MBS9946277-01 48 Well

Sheep Ladinin-1 (LAD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Ladinin-1 (LAD1) ELISA Kit
MBS9946277-02 96 Well

Sheep Ladinin-1 (LAD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Ladinin-1 (LAD1) ELISA Kit
MBS9946277-03 5x 96 Well

Sheep Ladinin-1 (LAD1) ELISA Kit

Sign In for Pricing
View Details
Sheep Ladinin-1 (LAD1) ELISA Kit
MBS9946277-04 10x 96 Well

Sheep Ladinin-1 (LAD1) ELISA Kit

Sign In for Pricing
View Details
Beta-2-Glycoprotein 1 (APOH) Antibody
abx170559-01 100 µL

Beta-2-Glycoprotein 1 (APOH) Antibody

Sign In for Pricing
View Details