Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL48 Rabbit Polyclonal Antibody (FITC)

MRPL48 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L48MT, CGI-118, HSPC290, MRP-L48

UniProt

Q96GC5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL48

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dnajc27 shRNA (UAS) - Lentiviral mouse Dnajc27 shRNA (UAS) plasmid
GTR15231583 1 Vial

Lentiviral mouse Dnajc27 shRNA (UAS) - Lentiviral mouse Dnajc27 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Fgf6 AAV siRNA Pooled Vector
20507166 1.0 µg

Fgf6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Aurora A Recombinant Antibody, FITC Conjugated
bsm-52018R-FITC 100 µL

Aurora A Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Lentiviral human ANK3 shRNA (UAS) - Lentiviral human ANK3 shRNA (UAS, iRFP) (25)
GTR15326333 1 Vial

Lentiviral human ANK3 shRNA (UAS) - Lentiviral human ANK3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ABHD15 Human qPCR Primer Pair (NM_198147)
HP219282 200 Reactions

ABHD15 Human qPCR Primer Pair (NM_198147)

Sign In for Pricing
View Details
JIP1 (Phospho-Thr103) Antibody
8A0954-AAT 50 µg

JIP1 (Phospho-Thr103) Antibody

Sign In for Pricing
View Details