Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL48 Rabbit Polyclonal Antibody (HRP)

MRPL48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L48MT, CGI-118, HSPC290, MRP-L48

UniProt

Q96GC5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GNA14 Antibody
NBP3-05016-100ul 100 µL

Rabbit Polyclonal GNA14 Antibody

Sign In for Pricing
View Details
Centrin 3 Recombinant Protein Antigen
NBP2-56231PEP 100 µL

Centrin 3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Polystyrene A CHO
HA40045006.25G 25 g

Polystyrene A CHO

Sign In for Pricing
View Details
Tankyrase-2 Lentiviral Activation Particles (h)
sc-403925-LAC 200 µL

Tankyrase-2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS, iRFP) plasmid
GTR15301519 1 Vial

Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human Interleukin 1 Beta (IL1b) ELISA Kit
EK14823 48 Tests

Human Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details