Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPRKB Rabbit Polyclonal Antibody (FITC)

TPRKB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGI121, GAMOS5, CGI-121

UniProt

Q9Y3C4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TPRKB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA4L 3'UTR Luciferase Stable Cell Line
TU010252 1.0 mL

HSPA4L 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DPEP1 (NM_004413) Human Tagged ORF Clone
RG201964 10 µg

DPEP1 (NM_004413) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rab 5A (A-12) : m-IgG1 BP-HRP Bundle
sc-541922 1 Kit

Rab 5A (A-12) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
PIRC37 Recombinant Protein (Human)
RP083466 100 µg

PIRC37 Recombinant Protein (Human)

Sign In for Pricing
View Details
Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag
584204-01 20 µg

Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag
584204-02 100 µg

Dehydrin Xero 2, Recombinant, Arabidopsis thaliana, aa1-193, His-Tag, Myc-Tag

Sign In for Pricing
View Details