Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med31 Rabbit Polyclonal Antibody (FITC)

Med31 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1309457

UniProt

D4A7J4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Med31

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001129285

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit
MBS723387-01 48 Well

Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit
MBS723387-02 96 Well

Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit
MBS723387-03 5x 96 Well

Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit
MBS723387-04 10x 96 Well

Guinea pig Anti mutated citrullinated Vimentin Antibody ELISA Kit

Sign In for Pricing
View Details
Human PHF19 Recombinant Protein, N-His
ARO-P19329-01 50 µg

Human PHF19 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human PHF19 Recombinant Protein, N-His
ARO-P19329-02 100 µg

Human PHF19 Recombinant Protein, N-His

Sign In for Pricing
View Details