Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLOD4 Rabbit Polyclonal Antibody (HRP)

GLOD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HC71, CGI-150, C17orf25

UniProt

D3DTG9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GLOD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO2 AAV siRNA Pooled Vector
20314161 1.0 µg

FBXO2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SNX29 HDR Plasmid (m)
sc-428903-HDR 20 µg

SNX29 HDR Plasmid (m)

Sign In for Pricing
View Details
Human Interleukin-7 receptor subunit alpha ELISA Kit
MBS9428111-01 96 Tests

Human Interleukin-7 receptor subunit alpha ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-7 receptor subunit alpha ELISA Kit
MBS9428111-02 5x 96 Tests

Human Interleukin-7 receptor subunit alpha ELISA Kit

Sign In for Pricing
View Details
Human ACPL2/Acid phosphatase-like protein 2 ELISA Kit
MBS2905025-01 48 Well

Human ACPL2/Acid phosphatase-like protein 2 ELISA Kit

Sign In for Pricing
View Details
Human ACPL2/Acid phosphatase-like protein 2 ELISA Kit
MBS2905025-02 96 Well

Human ACPL2/Acid phosphatase-like protein 2 ELISA Kit

Sign In for Pricing
View Details