Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLOD4 Rabbit Polyclonal Antibody (HRP)

GLOD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HC71, CGI-150, C17orf25

UniProt

D3DTG9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GLOD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCAG-3xFLAG-US28_HCMVA (human) -EGFP-StrepII
BZ57057 1 Vial

PCAG-3xFLAG-US28_HCMVA (human) -EGFP-StrepII

Sign In for Pricing
View Details
ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ
MBS6364740-01 0.1 mL

ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ

Sign In for Pricing
View Details
ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ
MBS6364740-02 5x 0.1 mL

ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ

Sign In for Pricing
View Details
DRAM, CT (Damage-regulated autophagy modulator) (MaxLight 650) discontinued
034796-ML650 100 µL

DRAM, CT (Damage-regulated autophagy modulator) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human CLPTM1 Pre-designed siRNA Set B
SI003249B 1 Each

Human CLPTM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Tumor Necrosis Factor alpha (TNFa)
T9160 100 µg

Tumor Necrosis Factor alpha (TNFa)

Sign In for Pricing
View Details