Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RWDD1 Rabbit Polyclonal Antibody (FITC)

RWDD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGI-24, PTD013

UniProt

A8MT24

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RWDD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S Protein Nanobody
E55A13235 100 µg

SARS-CoV-2 S Protein Nanobody

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC12 Antibody [Alexa Fluor 350]
NBP3-05950AF350 0.1 mL

Rabbit Polyclonal ZDHHC12 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit
abx152932-01 96 Tests

Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit
abx152932-02 5x 96 Tests

Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit

Sign In for Pricing
View Details
Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit
abx152932-03 10x 96 Tests

Human RNA Binding Motif Protein 3 (RBM3) ELISA Kit

Sign In for Pricing
View Details
ACN9 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12444R-BF350 100 µL

ACN9 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details