Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL6B Rabbit Polyclonal Antibody (FITC)

ACTL6B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACTL6, DEE76, BAF53B, EIEE76, IDDSSAD, arpNalpha

UniProt

O94805

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTL6B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057272

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD20 Antibody (rMS4A1/8044) [DyLight 350]
NBP3-24142UV 0.1 mL

Mouse Monoclonal CD20 Antibody (rMS4A1/8044) [DyLight 350]

Sign In for Pricing
View Details
ZNF74 (NM_003426) Human 3' UTR Clone
SC214903 10 µg

ZNF74 (NM_003426) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Human VWC2L Protein, His (Fc)-Avi-tagged
VWC2L-2350H 50 µg

Recombinant Human VWC2L Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Monkey TGFβ2 ELISA Kit
EMKT0012 96 Tests

Monkey TGFβ2 ELISA Kit

Sign In for Pricing
View Details
Goat Cytoplasmic Linker Associated Protein 2 ELISA Kit
MBS7258623-01 48 Well

Goat Cytoplasmic Linker Associated Protein 2 ELISA Kit

Sign In for Pricing
View Details
Goat Cytoplasmic Linker Associated Protein 2 ELISA Kit
MBS7258623-02 96 Well

Goat Cytoplasmic Linker Associated Protein 2 ELISA Kit

Sign In for Pricing
View Details