Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECA Rabbit Polyclonal Antibody (Biotin)

HECA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HDC, HDCL, HHDC, dJ225E12.1

UniProt

Q9UBI9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HECA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057301

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPAR, Cynomolgus (HEK293, Fc)
HY-P704953 100 µg

UPAR, Cynomolgus (HEK293, Fc)

Sign In for Pricing
View Details
RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase M2 subunit, R2, RR2M) (MaxLight 750)
MBS6436394-01 0.1 mL

RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase M2 subunit, R2, RR2M) (MaxLight 750)

Sign In for Pricing
View Details
RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase M2 subunit, R2, RR2M) (MaxLight 750)
MBS6436394-02 5x 0.1 mL

RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase M2 subunit, R2, RR2M) (MaxLight 750)

Sign In for Pricing
View Details
SSX-pan Blocking Peptide
MBS823702-01 1 mg

SSX-pan Blocking Peptide

Sign In for Pricing
View Details
SSX-pan Blocking Peptide
MBS823702-02 5 mg

SSX-pan Blocking Peptide

Sign In for Pricing
View Details
SSX-pan Blocking Peptide
MBS823702-03 5x 5 mg

SSX-pan Blocking Peptide

Sign In for Pricing
View Details