Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECA Rabbit Polyclonal Antibody (HRP)

HECA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HDC, HDCL, HHDC, dJ225E12.1

UniProt

Q9UBI9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HECA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057301

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Klrd1/CD94 Antibody Picoband® (Dylight488 Conjugate)
A03257-3-Dylight488 100 µg

Anti-Klrd1/CD94 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Abi-1 Polyclonal Antibody
MBS9242600-01 0.1 mL

Abi-1 Polyclonal Antibody

Sign In for Pricing
View Details
Abi-1 Polyclonal Antibody
MBS9242600-02 5x 0.1 mL

Abi-1 Polyclonal Antibody

Sign In for Pricing
View Details
Research Grade Naxitamab
DGK07803 100 μg

Research Grade Naxitamab

Sign In for Pricing
View Details
Golgin 97 recombinant monoclonal antibody
A5802 100ul X 3

Golgin 97 recombinant monoclonal antibody

Sign In for Pricing
View Details
DEFB124 Human Over-expression Lysate
orb1343418 100 µg

DEFB124 Human Over-expression Lysate

Sign In for Pricing
View Details