Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn4 Rabbit Polyclonal Antibody (HRP)

Dctn4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P6, p62, 1110001K06Rik, 4930547K17Rik, C130039E17Rik

UniProt

Q3TQY2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 23 Receptor (IL23R) Antibody
abx211458-01 50 µL

Interleukin 23 Receptor (IL23R) Antibody

Sign In for Pricing
View Details
Interleukin 23 Receptor (IL23R) Antibody
abx211458-02 100 µL

Interleukin 23 Receptor (IL23R) Antibody

Sign In for Pricing
View Details
OTTMUSG00000002043 siRNA (m)
sc-151396 10 µM

OTTMUSG00000002043 siRNA (m)

Sign In for Pricing
View Details
Monnierisides A
HY-N11037 1 Each

Monnierisides A

Sign In for Pricing
View Details
Recombinant other PhI p 2 Protein, His, Insect-100ug
QP13041-100ug 100ug

Recombinant other PhI p 2 Protein, His, Insect-100ug

Sign In for Pricing
View Details
SIGIRR, CT (Single Ig IL-1-Related Receptor, Single Ig IL-1R-Related Molecule, Single Immunoglobulin Domain-Containing IL1R-Related Protein, Toll/Interleukin-1 Receptor 8, TIR8) (MaxLight 750) discontinued
S1013-68F-ML750 100 µL

SIGIRR, CT (Single Ig IL-1-Related Receptor, Single Ig IL-1R-Related Molecule, Single Immunoglobulin Domain-Containing IL1R-Related Protein, Toll/Interleukin-1 Receptor 8, TIR8) (MaxLight 750) discontinued

Sign In for Pricing
View Details