Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r4 Rabbit Polyclonal Antibody (FITC)

Cyb5r4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ncb, B5+B5, b5/b5, b5b5r, B5+B5R, C79736, Ncb5or, b5/b5r, Cb5cb5r, 2810034J18Rik

UniProt

Q3TDX8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit
MBS7210114-01 48 Well

Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit
MBS7210114-02 96 Well

Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit
MBS7210114-03 5x 96 Well

Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit
MBS7210114-04 10x 96 Well

Rabbit Olfactory receptor 5M3 (OR5M3) ELISA Kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055441-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055441-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details