Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r4 Rabbit Polyclonal Antibody (FITC)

Cyb5r4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ncb, B5+B5, b5/b5, b5b5r, B5+B5R, C79736, Ncb5or, b5/b5r, Cb5cb5r, 2810034J18Rik

UniProt

Q3TDX8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041H-01 20 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041H-02 100 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF594 conjugate, 0.1mg/mL
BNC941757-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse PGRL/IGSF8 Protein (His Tag)
PKSM040380 100 µg

Recombinant Mouse PGRL/IGSF8 Protein (His Tag)

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF568 conjugate, 0.1mg/mL
BNC683137-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details