Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r4 Rabbit Polyclonal Antibody (HRP)

Cyb5r4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ncb, B5+B5, b5/b5, b5b5r, B5+B5R, C79736, Ncb5or, b5/b5r, Cb5cb5r, 2810034J18Rik

UniProt

Q3TDX8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UVC Sterilizer BSTE-302
BSTE-302 Each

UVC Sterilizer BSTE-302

Sign In for Pricing
View Details
Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate
LC400883 20 µg

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF809510 100 µg

OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]

Sign In for Pricing
View Details
G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein
TP315437L 1 mg

G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein

Sign In for Pricing
View Details
PLAGL1 (NM_001080956) Human Over-expression Lysate
LC421140 20 µg

PLAGL1 (NM_001080956) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS712998 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details