Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ak3 Rabbit Polyclonal Antibody (HRP)

Ak3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AK-, AK-3, Ak3l, Ak3l1, Akl3l, AA407498, AI506714

UniProt

Q9WTP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcf7l2 (NM_001142918) Mouse Tagged Lenti ORF Clone
MR224173L3 10 µg

Tcf7l2 (NM_001142918) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SERINC3 Rabbit Polyclonal Antibody (Carrier-free)
orb3102691 100 µg

SERINC3 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Cyclopropyl 2-fluorobenzyl ketone
269554-01 5 g

Cyclopropyl 2-fluorobenzyl ketone

Sign In for Pricing
View Details
Cyclopropyl 2-fluorobenzyl ketone
269554-02 10 g

Cyclopropyl 2-fluorobenzyl ketone

Sign In for Pricing
View Details
Cyclopropyl 2-fluorobenzyl ketone
269554-03 25 g

Cyclopropyl 2-fluorobenzyl ketone

Sign In for Pricing
View Details
Cyclopropyl 2-fluorobenzyl ketone
269554-04 50 g

Cyclopropyl 2-fluorobenzyl ketone

Sign In for Pricing
View Details